General Information

  • ID:  hor000520
  • Uniprot ID:  A0A0L0C6U5
  • Protein name:  Allatostatin-4
  • Gene name:  NA
  • Organism:  Lucilia cuprina (Green bottle fly) (Australian sheep blowfly)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lucilia (genus), Luciliinae (subfamily), Calliphoridae (family), Oestroidea (superfamily), Calyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  NRPYSFGL
  • Length:  8(150-157)
  • Propeptide:  MNKRFVSLLMLACWLSVAYSEPSYEDTASQVNSPNGGHQANSLFNTNADSNMDGDNMDGMIMGAGLGNKDNYDKRVERYAFGLGRRAYTYTNGGNGIKRLPVYNFGLGKRARPYSFGLGKRSDYEDSDAQIAEDLDRAYNAAFMMDEKRNRPYSFGLGKRDPLNEERRANRYGFGLGRR
  • Signal peptide:  MNKRFVSLLMLACWLSVAYS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A0L0C6U5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000520_AF2.pdbhor000520_ESM.pdb

Physical Information

Mass: 107809 Formula: C44H64N12O12
Absent amino acids: ACDEHIKMQTVW Common amino acids: FGLNPRSY
pI: 9.35 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -68.75 Boman Index: -1626
Half-Life / Aliphatic Index: 1.4 hour Aliphatic Index: 48.75
Instability Index: 3282.5 Extinction Coefficient cystines: 1490
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  23280433
  • Title:  Neuropeptidomics of the Australian Sheep Blowfly Lucilia Cuprina (Wiedemann) and Related Diptera